4.67 Rating by ClearWebStats
jenniferchemsales.com is 1 year 5 months 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, jenniferchemsales.com is SAFE to browse.
Get Custom Widget

Traffic Report of Jenniferchemsales

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: 7 ON 100 Click to see jenniferchemsales.com data on Moz
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View jenniferchemsales.com site advisor rating Not Applicable

Where is jenniferchemsales.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with jenniferchemsales.com

Hosted Country:

jenniferchemsales.com hosted country US jenniferchemsales.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View jenniferchemsales.com HTML resources

Homepage Links Analysis

Home - Jennifer Chem Sales

Website Inpage Analysis

H1 Headings: 3 H2 Headings: 50
H3 Headings: 10 H4 Headings: 3
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 56
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

jenniferchemsales.com favicon - shrivishwakarmasafetytraininginstitute.com

View jenniferchemsales.com Pagerank   jenniferchemsales.com alexa rank Not Applicable   jenniferchemsales.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

jenniferchemsales.com favicon - theshineenglishacademy.com

View jenniferchemsales.com Pagerank   jenniferchemsales.com alexa rank Not Applicable   jenniferchemsales.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

jenniferchemsales.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View jenniferchemsales.com Pagerank   jenniferchemsales.com alexa rank Not Applicable   jenniferchemsales.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

jenniferchemsales.com favicon - 247bestpillpharma.com

View jenniferchemsales.com Pagerank   jenniferchemsales.com alexa rank Not Applicable   jenniferchemsales.com website value $ 8.95

US Pharmacy Front

jenniferchemsales.com favicon - uspharmacyfront.com

View jenniferchemsales.com Pagerank   jenniferchemsales.com alexa rank Not Applicable   jenniferchemsales.com website value $ 8.95

HTTP Header Analysis

HTTP/2 200
link: <https://www.jenniferchemsales.com/wp-json/>; rel="https://api.w.org/", <https://www.jenniferchemsales.com/wp-json/wp/v2/pages/1056>; rel="alternate"; type="application/json", <https://www.jenniferchemsales.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Tue, 28 Mar 2023 23:36:43 GMT
server: Apache

Domain Information for jenniferchemsales.com

Domain Registrar: GANDI SAS jenniferchemsales.com registrar info
Registration Date: 2022-11-26 1 year 5 months 3 weeks ago
Last Modified: 2022-11-26 1 year 5 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net jenniferchemsales.com name server information 162.241.148.33 jenniferchemsales.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net jenniferchemsales.com name server information 162.241.148.33 jenniferchemsales.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
jenniferchemsales.com A 14400 IP:162.241.148.33
jenniferchemsales.com NS 21600 Target:ns1.bh-ht-17.webhostbox.net
jenniferchemsales.com NS 21600 Target:ns2.bh-ht-17.webhostbox.net
jenniferchemsales.com SOA 21600 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:root.bh-ht-17.webhostbox.net
Serial:2023012701
Refresh:86400
Retry:7200
Expire:3600000
jenniferchemsales.com MX 14400 Target:mail.jenniferchemsales.com
jenniferchemsales.com TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Jenniferchemsales

Google

jenniferchemsales.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View jenniferchemsales.com Pagerank   Alexa rank for jenniferchemsales.com 1   website value of jenniferchemsales.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

jenniferchemsales.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View jenniferchemsales.com Pagerank   Alexa rank for jenniferchemsales.com 1   website value of jenniferchemsales.com $ 8,833,062,960.00

Gmail

jenniferchemsales.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View jenniferchemsales.com Pagerank   Alexa rank for jenniferchemsales.com 1   website value of jenniferchemsales.com $ 8,833,062,960.00

Android Apps on Google Play

jenniferchemsales.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View jenniferchemsales.com Pagerank   Alexa rank for jenniferchemsales.com 1   website value of jenniferchemsales.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

jenniferchemsales.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View jenniferchemsales.com Pagerank   Alexa rank for jenniferchemsales.com 1   website value of jenniferchemsales.com $ 8,833,062,960.00

Full WHOIS Lookup for jenniferchemsales.com

Domain Name: JENNIFERCHEMSALES.COM
Registry Domain ID: 2740923078_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.gandi.net
Registrar URL: http://www.gandi.net
Updated Date: 2022-11-26T10:29:38Z
Creation Date: 2022-11-26T10:27:04Z
Registry Expiry Date: 2023-11-26T10:27:04Z
Registrar: Gandi SAS
Registrar IANA ID: 81
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +33.170377661
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-03-28T23:36:53Z